Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433631467
StrainM_canettii_CIPT_140070010
Protein IDYP_007265095.1
Description Putative membrane-associated phospholipase C 1 PlcA (MTP40 antigen)
Sequence MSRREFLTKLTGAGAAAFLMDWAAPVIEKAYGAGPCPGHLTDIEHIVLLM
QENRSFDHYFGTLSSTNGFNAASPAFQQMGWNPMTQALDPAGVTIPFRLD
TTRGPFLDGECVNDPEHQWVGMHLAWNGGANDNWLPAQATTRAGPYVPLT
MGYYTRQDIPIHYLLADTFTICDGYHCSLLTGTLPNRLYWLSANIDPAGT
DGGPQLVEPGFMPLQQYSWRIMPENLEDAGVSWKVYQNKDLGRFINTPIS
NNGLVQAFRQSADPRSNLARYGIAPTYPGDFAADVRANRLPKVSWLVPNI
LQSEHPALPVALGAVSMVTALRILLSNPAVWEKTALIVSYDENGGFFDHV
TPPTAPPGTPGEFVTVPNIDAVPGSGGIRGPLGLGFRVPCIVISPYSRGP
LMVSDTFDHTSQLKLIRARFGVPVPNLTAWRDGVVGDMTSAFNFATPPNS
TRPNLSHPLLAAVPKLPQCIPNVVLGTTDGALPSIPYRVPFPQVMPTQET
TPVRGTPSGLCS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)118
MHC class II prediction (Propred)142
MHC class 1 prediction (Propred1)650
CTL epitope prediction (CTLpred)126
Prediction of interferon-gamma inducing peptides (IFNepitope)356
Prediction of IL4 inducing peptides (IL4pred)706