Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433631548
StrainM_canettii_CIPT_140070010
Protein IDYP_007265176.1
Description Conserved protein of unknown function- PPE family protein [Mycobact
Sequence MHFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLL
SLMDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAH
HDMVPLAQIYNNRAERQILIDNNALGQFTAQIADLDQEYDDFWDEDGEVM
RDYRLRVSDALSKLTPWKAPPPIAHSTVLVAPVSPSTASSRTDT
B cell epitope (IEDB)1
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)30
MHC class 1 prediction (Propred1)130
CTL epitope prediction (CTLpred)30
Prediction of interferon-gamma inducing peptides (IFNepitope)61
Prediction of IL4 inducing peptides (IL4pred)110