Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433631562
StrainM_canettii_CIPT_140070010
Protein IDYP_007265190.1
Description Putative nucleoside diphosphate kinase NdkA (NDK) (NDP kinase) (nuc
Sequence MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY
AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAP
GTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)19
MHC class 1 prediction (Propred1)84
CTL epitope prediction (CTLpred)19
Prediction of interferon-gamma inducing peptides (IFNepitope)58
Prediction of IL4 inducing peptides (IL4pred)88