Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433633199
StrainM_canettii_CIPT_140010059
Protein IDYP_007266826.1
Description Putative alternative RNA polymerase Sigma factor SigG (RNA polymera
Sequence MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAENSGREP
ADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEG
FAGKSSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERR
EMSWLEPLPDVTDDPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLR
DVLQWKSAEVADAIGTSTVAVNSLLQRARSQLQTVRPSAADRLSAPDSPE
AQDLLARYIAAFEAYDIDRLVELFTAEAIWEMPPYIGWYQGAQAIVTLIH
QQCPADSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLQVLDMAADRVS
HVVAFLDTTLFPKFGLPDSL
gene ID433633199
StrainM_canettii_CIPT_140070017
Protein IDYP_007266826.1
Description Putative alternative RNA polymerase Sigma factor SigG (RNA polymera
Sequence MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAENSGREP
ADERRGDFSAHTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEG
FAGKSSLRTWLHRIATNTCLTALEGRRRRPLPTGLGRPSADPSGELVERR
EMSWLEPLPDVTDDPADPSTIVGNRESVRLAFVAALQHLSPRQRAVLLLR
DVLQWKSAEVADAIGTSTVAVNSLLQRARSQLQTVRPSAADRLSAPDSPE
AQDLLARYIAAFEAYDIDRLVELFTAEAIWEMPPYIGWYQGAQAIVTLIH
QQCPADSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLQVLDMAADRVS
HVVAFLDTTLFPKFGLPDSL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)62
MHC class 1 prediction (Propred1)260
CTL epitope prediction (CTLpred)62
Prediction of interferon-gamma inducing peptides (IFNepitope)147
Prediction of IL4 inducing peptides (IL4pred)254