Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433633217
StrainM_canettii_CIPT_140010059
Protein IDYP_007266844.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIASTLLG
VLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNID
ASLQRLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHR
ELDTQSGAARPVVTTKLPPFATRTDSVLLVATSVSENAGAQPQTVHWNLR
LDVSDVDGKLMISRLESIR
gene ID433633217
StrainM_canettii_CIPT_140070017
Protein IDYP_007266844.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIASTLLG
VLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNID
ASLQRLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHR
ELDTQSGAARPVVTTKLPPFATRTDSVLLVATSVSENAGAQPQTVHWNLR
LDVSDVDGKLMISRLESIR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)8
MHC class II prediction (Propred)29
MHC class 1 prediction (Propred1)149
CTL epitope prediction (CTLpred)33
Prediction of interferon-gamma inducing peptides (IFNepitope)52
Prediction of IL4 inducing peptides (IL4pred)126