Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433633853
StrainM_canettii_CIPT_140010059
Protein IDYP_007267480.1
Description Phosphoribosylformylglycinamidine synthase II PurL (FGAM synthase I
Sequence MLDTVEHAATTPDQPQPYGELGLKDDEYRRIRQILGRRPTDTELAMYSVM
WSEHCSYKSSKVHLRYFGETTSDEMRAAMLAGIGENAGVVDIGDGWAVTF
KVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGPADAP
DTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDPCYAGNPLVNALCVGVLR
QEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTFDAEGSRKKLPS
VQVGDPFMEKVLIECCLELYAGGLVIGIQDLGGAGLSCATSELASAGDGG
MTIQLDSVPLRAKEMTPAEVLCSESQERMCAVVSPKNVDAFLAVCRKWEV
LAAVIGEVTDGDRLQITWHGETVVDVPPRTVAHEGPVYQRPVARPDSQDA
LNADRSAKLARPVTGDELRATLLALLGSPHLCSRAFITEQYDRYVRGNTV
LAEHADGGMLRVDESTGRGIAVSTDASGRYTLLDPYAGAQLALAEAYRNV
AVTGATPVAVTNCLNFGSPEDPGVMWQFAQAVRGLADGCAALGIPVTGGN
VSFYNQTGSAAILPTPVVGVLGVIDDVRRRIPTGLGAEPGETLMLLGDTR
DEFDGSVWAQVTADHLGGLPPVVDLAREKLLAAVLSSASRDGLVSAAHDL
SEGGLAQAIVESALAGETGCRIVLPEGADPFVLLFSESAGRVLVAVPRTE
ESRFRGMCEARGLPAVRIGVVDQGSDAVEVQGLFTVSLAELRATSEAVLP
RYFG
gene ID433633853
StrainM_canettii_CIPT_140070017
Protein IDYP_007267480.1
Description Phosphoribosylformylglycinamidine synthase II PurL (FGAM synthase I
Sequence MLDTVEHAATTPDQPQPYGELGLKDDEYRRIRQILGRRPTDTELAMYSVM
WSEHCSYKSSKVHLRYFGETTSDEMRAAMLAGIGENAGVVDIGDGWAVTF
KVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGPADAP
DTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDPCYAGNPLVNALCVGVLR
QEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTFDAEGSRKKLPS
VQVGDPFMEKVLIECCLELYAGGLVIGIQDLGGAGLSCATSELASAGDGG
MTIQLDSVPLRAKEMTPAEVLCSESQERMCAVVSPKNVDAFLAVCRKWEV
LAAVIGEVTDGDRLQITWHGETVVDVPPRTVAHEGPVYQRPVARPDSQDA
LNADRSAKLARPVTGDELRATLLALLGSPHLCSRAFITEQYDRYVRGNTV
LAEHADGGMLRVDESTGRGIAVSTDASGRYTLLDPYAGAQLALAEAYRNV
AVTGATPVAVTNCLNFGSPEDPGVMWQFAQAVRGLADGCAALGIPVTGGN
VSFYNQTGSAAILPTPVVGVLGVIDDVRRRIPTGLGAEPGETLMLLGDTR
DEFDGSVWAQVTADHLGGLPPVVDLAREKLLAAVLSSASRDGLVSAAHDL
SEGGLAQAIVESALAGETGCRIVLPEGADPFVLLFSESAGRVLVAVPRTE
ESRFRGMCEARGLPAVRIGVVDQGSDAVEVQGLFTVSLAELRATSEAVLP
RYFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo