Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634407
StrainM_canettii_CIPT_140010059
Protein IDYP_007268034.1
Description Conserved membrane lipoprotein of unknown function- LprD [Mycobacte
Sequence MSPTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWP
LFAWFCVYAYRNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDD
PALREYNAYLAELAKDDAKKQNRTTA
gene ID433634407
StrainM_canettii_CIPT_140070017
Protein IDYP_007268034.1
Description Conserved membrane lipoprotein of unknown function- LprD [Mycobacte
Sequence MSPTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWP
LFAWFCVYAYRNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDD
PALREYNAYLAELAKDDAKKQNRTTA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo