Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634575
StrainM_canettii_CIPT_140010059
Protein IDYP_007268202.1
Description Putative nucleotide-sugar epimerase EpiA [Mycobacterium canettii CI
Sequence MNAHTSVGPLDRAAGVYIAGHRGLVGSALLRTFAGAGFTNLLVRSRAELD
LTDRAATFDFVLESRPQVVIDAAARVGGILANDTYPADFLSENLQIQVNL
LDAAVAARVPRLLFLGSSCIYPKLAPQPIPESALLTGPLEPTNDAYAIAK
IAGILAVQAVRRQHGLPWISAMPTNLYGPGDNFSPSGSHLLPALIRRYDE
AKASGAPNVTNWGTGTPRRELLHVDDLASACLYLLEHFDGPTHVNVGTGI
DHTIGEIAEMVASAVGYSGETRWDPSKPDGTPRKLLDVSVLREAGWRPSI
ALRDGIEATVAWYREHAGTVRQ
gene ID433634575
StrainM_canettii_CIPT_140070017
Protein IDYP_007268202.1
Description Putative nucleotide-sugar epimerase EpiA [Mycobacterium canettii CI
Sequence MNAHTSVGPLDRAAGVYIAGHRGLVGSALLRTFAGAGFTNLLVRSRAELD
LTDRAATFDFVLESRPQVVIDAAARVGGILANDTYPADFLSENLQIQVNL
LDAAVAARVPRLLFLGSSCIYPKLAPQPIPESALLTGPLEPTNDAYAIAK
IAGILAVQAVRRQHGLPWISAMPTNLYGPGDNFSPSGSHLLPALIRRYDE
AKASGAPNVTNWGTGTPRRELLHVDDLASACLYLLEHFDGPTHVNVGTGI
DHTIGEIAEMVASAVGYSGETRWDPSKPDGTPRKLLDVSVLREAGWRPSI
ALRDGIEATVAWYREHAGTVRQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)18
MHC class II prediction (Propred)86
MHC class 1 prediction (Propred1)438
CTL epitope prediction (CTLpred)94
Prediction of interferon-gamma inducing peptides (IFNepitope)228
Prediction of IL4 inducing peptides (IL4pred)398