Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634689
StrainM_canettii_CIPT_140010059
Protein IDYP_007268316.1
Description Putative excinuclease ABC (subunit A-DNA-binding ATPase) UvrA [Myco
Sequence MADRLIVKGAREHNLRSVDLDLPRDALIVFTGLSGSGKSSLAFDTIFAEG
QRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVG
TITEVYDYLRLLYARAGTPHCPTCGERIARQTPQQIVDQVLAMPEGTRFL
VLAPVVRTRKGEFADLFDKLNAQGYSRVRVDGVVHPLTDPPKLKKQEKHD
IEVVVDRLTVKAAAKRRLTDSVETALNLADGIVVLEFVDHELGAPHREQR
FSEKLACPNGHALAVDDLEPRSFSFNSPYGACPECSGLGIRKEVDPELVV
PDPDRTLAQGAVAPWSNGHTAEYFTRMMAGLGEALGFDVDTPWRKLPAKA
RKAILEGADEQVHVRYRNRYGRTRSYYADFEGVLAFLQRKMSQTESEQMK
ERYEGFMRDVPCPVCAGTRLKPEILAVTLAGESKGEHGAKSIAEVCELSI
ADCADFLNALTLGPREQAIAGQVLKEIRSRLGFLLDVGLEYLSLSRAAAT
LSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNRRLIETLTRLRD
LGNTLIVVEHDEDTIEHADWIVDIGPGAGEHGGRIVHSGPYDELLRNKDS
ITGAYLSGRESIEIPAIRRPVDPRRQLTVVGAREHNLRGIDVSFPLGVLT
SVTGVSGSGKSTLVNDILAAVLANRLNGARQVPGRHTRVTGLDYLDKLVR
VDQSPIGRTPRSNPATYTGVFDKIRTLFAATTEAKVRGYQPGRFSFNVKG
GRCEACTGDGTIKIEMNFLPDVYVPCEVCQGARYNRETLEVHYKGKTVSE
VLDMSIEEAAEFFEPIAGIHRYLRTLVDVGLGYVRLGQPAPTLSGGEAQR
VKLASELQKRSTGRTVYILDEPTTGLHFDDIRKLLNVINGLVDKGNTVIV
IEHNLDVIKTSDWIIDLGPEGGAGGGTVVAQGTPEDVAAVPASYTGKFLA
EVVGGGASAATSRSNRRRKVSA
gene ID433634689
StrainM_canettii_CIPT_140070017
Protein IDYP_007268316.1
Description Putative excinuclease ABC (subunit A-DNA-binding ATPase) UvrA [Myco
Sequence MADRLIVKGAREHNLRSVDLDLPRDALIVFTGLSGSGKSSLAFDTIFAEG
QRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVG
TITEVYDYLRLLYARAGTPHCPTCGERIARQTPQQIVDQVLAMPEGTRFL
VLAPVVRTRKGEFADLFDKLNAQGYSRVRVDGVVHPLTDPPKLKKQEKHD
IEVVVDRLTVKAAAKRRLTDSVETALNLADGIVVLEFVDHELGAPHREQR
FSEKLACPNGHALAVDDLEPRSFSFNSPYGACPECSGLGIRKEVDPELVV
PDPDRTLAQGAVAPWSNGHTAEYFTRMMAGLGEALGFDVDTPWRKLPAKA
RKAILEGADEQVHVRYRNRYGRTRSYYADFEGVLAFLQRKMSQTESEQMK
ERYEGFMRDVPCPVCAGTRLKPEILAVTLAGESKGEHGAKSIAEVCELSI
ADCADFLNALTLGPREQAIAGQVLKEIRSRLGFLLDVGLEYLSLSRAAAT
LSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNRRLIETLTRLRD
LGNTLIVVEHDEDTIEHADWIVDIGPGAGEHGGRIVHSGPYDELLRNKDS
ITGAYLSGRESIEIPAIRRPVDPRRQLTVVGAREHNLRGIDVSFPLGVLT
SVTGVSGSGKSTLVNDILAAVLANRLNGARQVPGRHTRVTGLDYLDKLVR
VDQSPIGRTPRSNPATYTGVFDKIRTLFAATTEAKVRGYQPGRFSFNVKG
GRCEACTGDGTIKIEMNFLPDVYVPCEVCQGARYNRETLEVHYKGKTVSE
VLDMSIEEAAEFFEPIAGIHRYLRTLVDVGLGYVRLGQPAPTLSGGEAQR
VKLASELQKRSTGRTVYILDEPTTGLHFDDIRKLLNVINGLVDKGNTVIV
IEHNLDVIKTSDWIIDLGPEGGAGGGTVVAQGTPEDVAAVPASYTGKFLA
EVVGGGASAATSRSNRRRKVSA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)4
Vaccine TargetNo