Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634719
StrainM_canettii_CIPT_140010059
Protein IDYP_007268346.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MIRAVWNGTVLAEAPRTVRVEGNHYFPPESLHREHLIESPTTSICPWKGL
AHYYNVVVDGPYGPVNPDAAWYYRRPSPLARRIKNHVAFWHGVTVEGESE
GRHGLARRVVAWLGK
gene ID433634719
StrainM_canettii_CIPT_140070017
Protein IDYP_007268346.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MIRAVWNGTVLAEAPRTVRVEGNHYFPPESLHREHLIESPTTSICPWKGL
AHYYNVVVDGPYGPVNPDAAWYYRRPSPLARRIKNHVAFWHGVTVEGESE
GRHGLARRVVAWLGK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)71
CTL epitope prediction (CTLpred)26
Prediction of interferon-gamma inducing peptides (IFNepitope)64
Prediction of IL4 inducing peptides (IL4pred)81