Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634805
StrainM_canettii_CIPT_140010059
Protein IDYP_007268432.1
Description Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]
Sequence MGETTTCAIIGGGPAGMVLGLLLARAGVQVTLLEKHGDFLRDFRGDTVHP
TTMRLLDELGLWERFAALPYSEVRTATLHSNGRAVTYIDFERLHQPYPYV
AMVPQWDLLNLLAEAAQAEPSFTLRMKTEVTGLLREGGKVTGVRYQGAEG
PGELRAELTVACDGRWSIARHEAGLKAREFPVNFDVWWFKLPREGDAEFS
FLPRFSPGKGLGVIPREGYFQIAYLGPKGTDAQLRERGIEEFRRDVSELL
PEATASVAALASMDEVKHLNVKVNRLRRWHIDGLLCIGDAAHAMSPVAGV
GINLAVQDAVAAATILAEPLREHRVSSRYLAAVRRRRAFPTAVTQAVQRV
LHRRLLGPLLQGRDPTPPAALLGLVERLPWLSAVPAYFVGVGVRPEHAPA
FARRGPGNRKGP
gene ID433634805
StrainM_canettii_CIPT_140070017
Protein IDYP_007268432.1
Description Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]
Sequence MGETTTCAIIGGGPAGMVLGLLLARAGVQVTLLEKHGDFLRDFRGDTVHP
TTMRLLDELGLWERFAALPYSEVRTATLHSNGRAVTYIDFERLHQPYPYV
AMVPQWDLLNLLAEAAQAEPSFTLRMKTEVTGLLREGGKVTGVRYQGAEG
PGELRAELTVACDGRWSIARHEAGLKAREFPVNFDVWWFKLPREGDAEFS
FLPRFSPGKGLGVIPREGYFQIAYLGPKGTDAQLRERGIEEFRRDVSELL
PEATASVAALASMDEVKHLNVKVNRLRRWHIDGLLCIGDAAHAMSPVAGV
GINLAVQDAVAAATILAEPLREHRVSSRYLAAVRRRRAFPTAVTQAVQRV
LHRRLLGPLLQGRDPTPPAALLGLVERLPWLSAVPAYFVGVGVRPEHAPA
FARRGPGNRKGP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo