Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634881
StrainM_canettii_CIPT_140010059
Protein IDYP_007268508.1
Description Putative hydrolase [Mycobacterium canettii CIPT 140070017]
Sequence MTSPSVREWRDGGRWLPTAVGKVFVRSGPGDTPTMLLLHGYPSSSFDFRA
VIPYLTGQAWVTMDFLGFGLSDKPRPHRYSLLEQADLVETVVAHTVTGAV
VVLAHDMGTSVTTELLARDLDGRLPFDLRRAVLSNGSVILERASLRPIQK
VLRSPLGPVAARLVSRGGFTRGFGRIFSPAHPLSAQEAQAQWELLCYNEG
NRIPHLLISYLDERIRHAQRWHGAVRDWPKPLGFVWGLDDPVATTNVLNG
LRELRPSAAVVELPGLGHYPQVEAPKAYAEAVLSLLVD
gene ID433634881
StrainM_canettii_CIPT_140070017
Protein IDYP_007268508.1
Description Putative hydrolase [Mycobacterium canettii CIPT 140070017]
Sequence MTSPSVREWRDGGRWLPTAVGKVFVRSGPGDTPTMLLLHGYPSSSFDFRA
VIPYLTGQAWVTMDFLGFGLSDKPRPHRYSLLEQADLVETVVAHTVTGAV
VVLAHDMGTSVTTELLARDLDGRLPFDLRRAVLSNGSVILERASLRPIQK
VLRSPLGPVAARLVSRGGFTRGFGRIFSPAHPLSAQEAQAQWELLCYNEG
NRIPHLLISYLDERIRHAQRWHGAVRDWPKPLGFVWGLDDPVATTNVLNG
LRELRPSAAVVELPGLGHYPQVEAPKAYAEAVLSLLVD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)70
MHC class II prediction (Propred)86
MHC class 1 prediction (Propred1)398
CTL epitope prediction (CTLpred)98
Prediction of interferon-gamma inducing peptides (IFNepitope)288
Prediction of IL4 inducing peptides (IL4pred)400