Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433634975
StrainM_canettii_CIPT_140010059
Protein IDYP_007268602.1
Description Conserved secreted protein of unknown function- immunogenic protein
Sequence MKLTTMIKTAVAVVAMATIATFAAPVAFAAYPITGKLGSELTMTDTVGQV
VLGWKVSDLKSSTAVIPGYPVAGQVWEATATVNAIRGSVTPAISQFNART
ADGINYRVLWQAAGPDTISGATIPQGEQSTGKIYFDVTGPSPTIVAMNNG
MEDLLIWEP
gene ID433634975
StrainM_canettii_CIPT_140070017
Protein IDYP_007268602.1
Description Conserved secreted protein of unknown function- immunogenic protein
Sequence MKLTTMIKTAVAVVAMATIATFAAPVAFAAYPITGKLGSELTMTDTVGQV
VLGWKVSDLKSSTAVIPGYPVAGQVWEATATVNAIRGSVTPAISQFNART
ADGINYRVLWQAAGPDTISGATIPQGEQSTGKIYFDVTGPSPTIVAMNNG
MEDLLIWEP
B cell epitope (IEDB)5
T cell epitope (IEDB)7
MHC binder (IEDB)22
Vaccine TargetNo