Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635082
StrainM_canettii_CIPT_140010059
Protein IDYP_007268709.1
Description Two component hypoxia sensor histidine kinase- DosT [Mycobacterium
Sequence MTHPDRANVNPGSPPLRETLSQLRLRELLLEVQDRIEQIVEGRDRLDGLI
DAILAITSGLKLDATLRAIVHTAAELVDARYGALGVRGYDHRLVEFVYEG
IDEETRHLIGSLPEGRGVLGALIEEPKPIRLDDISRHPASVGFPLHHPPM
RTFLGVPVRIRDEVFGNLYLTEKADGQPFSDDDEVLVQALAAAAGIAVDN
ARLFEESRTREAWIEATRDIGTQMLAGADPAMVFRLIAEEALTLMAAAAT
LVAVPLDDEAPACEVDDLVIVEVAGEISPALKQMTVAVSGTSIGGVFHDR
TPRRFDRLDLTVDGPVEPGPALVLPLRAADTVAGVLVALRRADEQPFSDK
QLDMMAAFADQAALAWRLATAQRQMREVEILTDRDRIARDLHDHVIQRLF
AVGLTLQGAAPRARVPAVRESIYSSIDDLQEIIQEIRSAIFDLHAGPSRA
TGLRHRLDKVIDQLAIPALHTTVQYTGPLSVVDTVLANHAEAVLREAVSN
AVRHANATSLAINVSVEDDVRVEVVDDGVGISGDITESGLRNLRQRADDA
GGEFTVENMPTGGTLLRWSAPLR
gene ID433635082
StrainM_canettii_CIPT_140070017
Protein IDYP_007268709.1
Description Two component hypoxia sensor histidine kinase- DosT [Mycobacterium
Sequence MTHPDRANVNPGSPPLRETLSQLRLRELLLEVQDRIEQIVEGRDRLDGLI
DAILAITSGLKLDATLRAIVHTAAELVDARYGALGVRGYDHRLVEFVYEG
IDEETRHLIGSLPEGRGVLGALIEEPKPIRLDDISRHPASVGFPLHHPPM
RTFLGVPVRIRDEVFGNLYLTEKADGQPFSDDDEVLVQALAAAAGIAVDN
ARLFEESRTREAWIEATRDIGTQMLAGADPAMVFRLIAEEALTLMAAAAT
LVAVPLDDEAPACEVDDLVIVEVAGEISPALKQMTVAVSGTSIGGVFHDR
TPRRFDRLDLTVDGPVEPGPALVLPLRAADTVAGVLVALRRADEQPFSDK
QLDMMAAFADQAALAWRLATAQRQMREVEILTDRDRIARDLHDHVIQRLF
AVGLTLQGAAPRARVPAVRESIYSSIDDLQEIIQEIRSAIFDLHAGPSRA
TGLRHRLDKVIDQLAIPALHTTVQYTGPLSVVDTVLANHAEAVLREAVSN
AVRHANATSLAINVSVEDDVRVEVVDDGVGISGDITESGLRNLRQRADDA
GGEFTVENMPTGGTLLRWSAPLR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)64
MHC class II prediction (Propred)68
MHC class 1 prediction (Propred1)396
CTL epitope prediction (CTLpred)95
Prediction of interferon-gamma inducing peptides (IFNepitope)249
Prediction of IL4 inducing peptides (IL4pred)381