Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635086
StrainM_canettii_CIPT_140010059
Protein IDYP_007268713.1
Description Heat shock protein HspX (alpha-crystallin homolog) (14 kDa antigen)
Sequence MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGR
YEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVR
TVSLPVGADEDDIKATYDKGILTVSVAVSEGRPTEKHIQIRSTN
gene ID433635086
StrainM_canettii_CIPT_140070017
Protein IDYP_007268713.1
Description Heat shock protein HspX (alpha-crystallin homolog) (14 kDa antigen)
Sequence MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGR
YEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVR
TVSLPVGADEDDIKATYDKGILTVSVAVSEGRPTEKHIQIRSTN
B cell epitope (IEDB)28
T cell epitope (IEDB)222
MHC binder (IEDB)550
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)14
MHC class 1 prediction (Propred1)99
CTL epitope prediction (CTLpred)17
Prediction of interferon-gamma inducing peptides (IFNepitope)70
Prediction of IL4 inducing peptides (IL4pred)53