Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635197
StrainM_canettii_CIPT_140010059
Protein IDYP_007268824.1
Description Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]
Sequence MTSLQGKVVFITGAARGIGAEVARRLHNKGAKLVLTDLSKSELAVMGAEL
GGDDHLLTVVADVRDLPAMQAAAETAVERFGGIDVVVANAGIASYGSVLK
VDPQAFRRVLDVNLLGNFHTVRATLPALIDRRGYVLIVSSLAAFAAPPGM
APYNMSKAGNEHFANALRLEVAHLGVSVGSAHMSWIDTALVRDTKADLPA
FAELLARLPWPLNKTTSVNKCAAAFVNGIEGRKDRVYCPGWVALFRWLKP
LLSTRVGQRPIRNTVAKLMPQMDAEVAALGRFASAYTESLENS
gene ID433635197
StrainM_canettii_CIPT_140070017
Protein IDYP_007268824.1
Description Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]
Sequence MTSLQGKVVFITGAARGIGAEVARRLHNKGAKLVLTDLSKSELAVMGAEL
GGDDHLLTVVADVRDLPAMQAAAETAVERFGGIDVVVANAGIASYGSVLK
VDPQAFRRVLDVNLLGNFHTVRATLPALIDRRGYVLIVSSLAAFAAPPGM
APYNMSKAGNEHFANALRLEVAHLGVSVGSAHMSWIDTALVRDTKADLPA
FAELLARLPWPLNKTTSVNKCAAAFVNGIEGRKDRVYCPGWVALFRWLKP
LLSTRVGQRPIRNTVAKLMPQMDAEVAALGRFASAYTESLENS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)32
MHC class II prediction (Propred)98
MHC class 1 prediction (Propred1)428
CTL epitope prediction (CTLpred)92
Prediction of interferon-gamma inducing peptides (IFNepitope)202
Prediction of IL4 inducing peptides (IL4pred)434