Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635433
StrainM_canettii_CIPT_140010059
Protein IDYP_007269060.1
Description Conserved protein of unknown function- PPE family- PPE38-like prote
Sequence MAADLRASASSFDAVIAGLAAGPWSGPASVAMAGAAAPYVGLVECGGRAG
GVVGWSGYRGGDGV
gene ID433635433
StrainM_canettii_CIPT_140070017
Protein IDYP_007269060.1
Description Conserved protein of unknown function- PPE family- PPE38-like prote
Sequence MAADLRASASSFDAVIAGLAAGPWSGPASVAMAGAAAPYVGLVECGGRAG
GVVGWSGYRGGDGV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)6
MHC class II prediction (Propred)5
MHC class 1 prediction (Propred1)37
CTL epitope prediction (CTLpred)9
Prediction of interferon-gamma inducing peptides (IFNepitope)27
Prediction of IL4 inducing peptides (IL4pred)36