Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635639
StrainM_canettii_CIPT_140010059
Protein IDYP_007269266.1
Description Putative RarA-like recombination factor protein [Mycobacterium cane
Sequence MPEAMSDGLFDVPGVPMTSGHDLGASAGAPLAVRMRPASLDEVVGQDHLL
APGSPLRRLVEGSGVASVILYGPPGSGKTTLAALISQATGRRFEALSALS
AGVKEVRAVIEVARRALLNGERTVLFIDEVHRFSKTQQDALLSAVENRVV
LLVAATTENPSFSVVAPLLSRSLILQLRPLTADDIRAVVQRAIDDPRGLG
REVVVAPEAVDLLVQLAAGDARRALTALEVAAEAAQAAGELVSVQTIERS
VDKAAVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRF
IARRLMILASEDIGMADPTALPVAVAAAQTVALIGMPEAQLTLAHATIHL
ATAPKSNAVTTALAAAMNDIKAGKAGLVPAHLRDGHYSGAAALGNAQGYK
YSHEDPDGVVAQQYPPDELVDVDYYRPTGRGGEREIAGRLDRLRAIIRKK
RG
gene ID433635639
StrainM_canettii_CIPT_140070017
Protein IDYP_007269266.1
Description Putative RarA-like recombination factor protein [Mycobacterium cane
Sequence MPEAMSDGLFDVPGVPMTSGHDLGASAGAPLAVRMRPASLDEVVGQDHLL
APGSPLRRLVEGSGVASVILYGPPGSGKTTLAALISQATGRRFEALSALS
AGVKEVRAVIEVARRALLNGERTVLFIDEVHRFSKTQQDALLSAVENRVV
LLVAATTENPSFSVVAPLLSRSLILQLRPLTADDIRAVVQRAIDDPRGLG
REVVVAPEAVDLLVQLAAGDARRALTALEVAAEAAQAAGELVSVQTIERS
VDKAAVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRF
IARRLMILASEDIGMADPTALPVAVAAAQTVALIGMPEAQLTLAHATIHL
ATAPKSNAVTTALAAAMNDIKAGKAGLVPAHLRDGHYSGAAALGNAQGYK
YSHEDPDGVVAQQYPPDELVDVDYYRPTGRGGEREIAGRLDRLRAIIRKK
RG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)5
Vaccine TargetNo