Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635773
StrainM_canettii_CIPT_140010059
Protein IDYP_007269400.1
Description Iron-dependent repressor and activator IdeR [Mycobacterium canettii
Sequence MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLEQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDAN
LVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETT
PGGGVTIVIPGHENVTLPHEMAHAVKVEKV
gene ID433635773
StrainM_canettii_CIPT_140070017
Protein IDYP_007269400.1
Description Iron-dependent repressor and activator IdeR [Mycobacterium canettii
Sequence MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLEQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDAN
LVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETT
PGGGVTIVIPGHENVTLPHEMAHAVKVEKV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)9
Vaccine TargetYes
B cell prediction (LBtope)14
MHC class II prediction (Propred)31
MHC class 1 prediction (Propred1)146
CTL epitope prediction (CTLpred)33
Prediction of interferon-gamma inducing peptides (IFNepitope)88
Prediction of IL4 inducing peptides (IL4pred)138