Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635933
StrainM_canettii_CIPT_140010059
Protein IDYP_007269560.1
Description Conserved protein of unknown function- probable GcpE protein [Mycob
Sequence MTVGLGMPQPPAPTLAPRRATRQLMVGNVGVGSDHPVSVQSMCTTKTHDV
NSTLQQIAELTAAGCDIVRVACPRQEDADALAEIARHSQIPVVADIHFQP
RYIFAAIDAGCAAVRVNPGNIKEFDGRVGEVAKAAGAAGIPIRIGVNAGS
LDKRFMEKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPVVMVA
AYEQLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSRGIGDTIRVSL
SAPPVEEVKVGNQVLESLNLRPRSLEIVSCPSCGRAQVDVYTLANEVTAG
LDGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVIKTVP
EAQIVETLIEEAMRLAAEMGEQDPGTTPSGSPIVTVS
gene ID433635933
StrainM_canettii_CIPT_140070017
Protein IDYP_007269560.1
Description Conserved protein of unknown function- probable GcpE protein [Mycob
Sequence MTVGLGMPQPPAPTLAPRRATRQLMVGNVGVGSDHPVSVQSMCTTKTHDV
NSTLQQIAELTAAGCDIVRVACPRQEDADALAEIARHSQIPVVADIHFQP
RYIFAAIDAGCAAVRVNPGNIKEFDGRVGEVAKAAGAAGIPIRIGVNAGS
LDKRFMEKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPVVMVA
AYEQLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSRGIGDTIRVSL
SAPPVEEVKVGNQVLESLNLRPRSLEIVSCPSCGRAQVDVYTLANEVTAG
LDGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVIKTVP
EAQIVETLIEEAMRLAAEMGEQDPGTTPSGSPIVTVS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo