Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635934
StrainM_canettii_CIPT_140010059
Protein IDYP_007269561.1
Description Membrane bound metalloprotease Rip [Mycobacterium canettii CIPT 140
Sequence MMFVTGIVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWST
RRGETEYGVKAVPLGGFCDIAGMTPVEELDPDERDRAMYKQATWKRVAVL
FAGPGMNLAICLVLIYAIALVWGLPNLHPPTRAVIGETGCVAQEVSQGKL
EQCAGPGPAALAGIRSGDVVVKVGDTPVSSFDEMAAAVRKSHGSVPIVVE
RDGTAIVTYVDIESTQRWIPNGQGGELQPATVGAIGVGAARVGPVRYGVF
SAVPATFAFTGDLTVEVGKALAAIPTKVGALVRAIGGGQRDPQTPISVVG
ASIIGGDTVDHGLWVAFWFFLAQLNLILAAINLLPLLPFDGGHIAVAVFE
RIRNMVRSARGKVAAAPVNYLKLMPATYVVLVLVVGYMLLTVTADLVNPI
RLFQ
gene ID433635934
StrainM_canettii_CIPT_140070017
Protein IDYP_007269561.1
Description Membrane bound metalloprotease Rip [Mycobacterium canettii CIPT 140
Sequence MMFVTGIVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWST
RRGETEYGVKAVPLGGFCDIAGMTPVEELDPDERDRAMYKQATWKRVAVL
FAGPGMNLAICLVLIYAIALVWGLPNLHPPTRAVIGETGCVAQEVSQGKL
EQCAGPGPAALAGIRSGDVVVKVGDTPVSSFDEMAAAVRKSHGSVPIVVE
RDGTAIVTYVDIESTQRWIPNGQGGELQPATVGAIGVGAARVGPVRYGVF
SAVPATFAFTGDLTVEVGKALAAIPTKVGALVRAIGGGQRDPQTPISVVG
ASIIGGDTVDHGLWVAFWFFLAQLNLILAAINLLPLLPFDGGHIAVAVFE
RIRNMVRSARGKVAAAPVNYLKLMPATYVVLVLVVGYMLLTVTADLVNPI
RLFQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)26
MHC class II prediction (Propred)86
MHC class 1 prediction (Propred1)289
CTL epitope prediction (CTLpred)86
Prediction of interferon-gamma inducing peptides (IFNepitope)160
Prediction of IL4 inducing peptides (IL4pred)265