Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433635963
StrainM_canettii_CIPT_140010059
Protein IDYP_007269590.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MALGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVR
AAVTNCGNSWPMARLTLALSPATLPKMGSVYDIALAAAVLSAQQKKPWER
LEKTLLLGELSLDGRVRPVRGVLPAVLAAKRDGWPAVVVPVDNLPEASLV
DGIDVRGVRTLGQLQSWLRGSTGLAGRITTADTTPESAADLADVVGQSQA
RFAVEVAAAGAHNLMLTGPPGVGKTMLAQRLPGLLPSLSGSESLEVTAIH
SVAGLLSGDTPLITRPPFVAPHHSSSVAALVGGGSGMARPGAVSRAHRGV
LFLDECAEISLSALEALRTPLEDGEIRLARRDGVACYPARFQLVLAANPC
PCAPADPQDCICAAATKRRYLGKLSGPLLDRVDLRVQMHRLRAGAFSAAD
GESTSQVRQRVALAREAAAQRWRPHGFRTNAEVSGPLLRRKFRPSSAAML
PLRTALDRGLLSIRGVDRTLRVAWSLADLAGRTSPGIDEVAAALSFRQPG
ARR
gene ID433635963
StrainM_canettii_CIPT_140070017
Protein IDYP_007269590.1
Description Conserved protein of unknown function [Mycobacterium canettii CIPT
Sequence MALGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVR
AAVTNCGNSWPMARLTLALSPATLPKMGSVYDIALAAAVLSAQQKKPWER
LEKTLLLGELSLDGRVRPVRGVLPAVLAAKRDGWPAVVVPVDNLPEASLV
DGIDVRGVRTLGQLQSWLRGSTGLAGRITTADTTPESAADLADVVGQSQA
RFAVEVAAAGAHNLMLTGPPGVGKTMLAQRLPGLLPSLSGSESLEVTAIH
SVAGLLSGDTPLITRPPFVAPHHSSSVAALVGGGSGMARPGAVSRAHRGV
LFLDECAEISLSALEALRTPLEDGEIRLARRDGVACYPARFQLVLAANPC
PCAPADPQDCICAAATKRRYLGKLSGPLLDRVDLRVQMHRLRAGAFSAAD
GESTSQVRQRVALAREAAAQRWRPHGFRTNAEVSGPLLRRKFRPSSAAML
PLRTALDRGLLSIRGVDRTLRVAWSLADLAGRTSPGIDEVAAALSFRQPG
ARR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo