Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636093
StrainM_canettii_CIPT_140010059
Protein IDYP_007269720.1
Description Putative tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransfera
Sequence MKVLAAMSGGVDSSVAAARMVDAGHEVVGVHMALSTAPGTLRTGSRGCCS
KEDAADARRVADVLGIPFYVWDFAEKFKEDVINDFVSSYARGETPNPCVR
CNQQIKFAALSARAVALGFDTVATGHYARLSGGRLRRAVDRDKDQSYVLA
VLTAQQLRHAAFPIGDTPKRQIRAEAARRGLAVANKPDSHDICFIPSGNT
KAFLGERIGVRHGAVVDADGAVLATHDGVHGFTIGQRKGLGIAGPGPNGR
PRYVTAIDADTATVHVGDVTDLDVQTLTGRAPVFTAGAAPSGPVDCVVQV
RAHGETVSAVAELIGDALFVQLHAPLRGVARGQTLVLYRPDPAGDEVLGS
ATIAGTSGLSTGGNPGA
gene ID433636093
StrainM_canettii_CIPT_140010059
Protein IDYP_007269720.1
Description Putative tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransfera
Sequence MKVLAAMSGGVDSSVAAARMVDAGHEVVGVHMALSTAPGTLRTGSRGCCS
KEDAADARRVADVLGIPFYVWDFAEKFKEDVINDFVSSYARGETPNPCVR
CNQQIKFAALSARAVALGFDTVATGHYARLSGGRLRRAVDRDKDQSYVLA
VLTAQQLRHAAFPIGDTPKRQIRAEAARRGLAVANKPDSHDICFIPSGNT
KAFLGERIGVRHGAVVDADGAVLATHDGVHGFTIGQRKGLGIAGPGPNGR
PRYVTAIDADTATVHVGDVTDLDVQTLTGRAPVFTAGAAPSGPVDCVVQV
RAHGETVSAVAELIGDALFVQLHAPLRGVARGQTLVLYRPDPAGDEVLGS
ATIAGTSGLSTGGNPGA
gene ID433636093
StrainM_canettii_CIPT_140070017
Protein IDYP_007269720.1
Description Putative tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransfera
Sequence MKVLAAMSGGVDSSVAAARMVDAGHEVVGVHMALSTAPGTLRTGSRGCCS
KEDAADARRVADVLGIPFYVWDFAEKFKEDVINDFVSSYARGETPNPCVR
CNQQIKFAALSARAVALGFDTVATGHYARLSGGRLRRAVDRDKDQSYVLA
VLTAQQLRHAAFPIGDTPKRQIRAEAARRGLAVANKPDSHDICFIPSGNT
KAFLGERIGVRHGAVVDADGAVLATHDGVHGFTIGQRKGLGIAGPGPNGR
PRYVTAIDADTATVHVGDVTDLDVQTLTGRAPVFTAGAAPSGPVDCVVQV
RAHGETVSAVAELIGDALFVQLHAPLRGVARGQTLVLYRPDPAGDEVLGS
ATIAGTSGLSTGGNPGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo