Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636181
StrainM_canettii_CIPT_140010059
Protein IDYP_007269808.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MTTSGTVLAASIAQHWHNFWRGEIGDWIFDRGLRIVMLLIAAVLAARFVT
WLANRVTRRLDLGFTESDALVRSEATKHRQAVALVISWVSIVLIYVVVVY
EIIDVLPVPVGALVGPAAVLGAALGFGAQRLVQDLLAGFFIIVEKQYGFG
DLVELSMVGSPENAAGTVEDVTLRVTKLRSSGGEVFTVPNGNIVKSVNLS
KDWARAVVDIPVPTSADLGRVNEVLHQECEHARHDSLLGELLLDEPTVMG
VERIEVDTVTLRLVARTLPGKQFEAGRQLRVLVIRALTRAGIVTAADARA
AVAESPEQ
gene ID433636181
StrainM_canettii_CIPT_140010059
Protein IDYP_007269808.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MTTSGTVLAASIAQHWHNFWRGEIGDWIFDRGLRIVMLLIAAVLAARFVT
WLANRVTRRLDLGFTESDALVRSEATKHRQAVALVISWVSIVLIYVVVVY
EIIDVLPVPVGALVGPAAVLGAALGFGAQRLVQDLLAGFFIIVEKQYGFG
DLVELSMVGSPENAAGTVEDVTLRVTKLRSSGGEVFTVPNGNIVKSVNLS
KDWARAVVDIPVPTSADLGRVNEVLHQECEHARHDSLLGELLLDEPTVMG
VERIEVDTVTLRLVARTLPGKQFEAGRQLRVLVIRALTRAGIVTAADARA
AVAESPEQ
gene ID433636181
StrainM_canettii_CIPT_140070017
Protein IDYP_007269808.1
Description Conserved membrane protein of unknown function [Mycobacterium canet
Sequence MTTSGTVLAASIAQHWHNFWRGEIGDWIFDRGLRIVMLLIAAVLAARFVT
WLANRVTRRLDLGFTESDALVRSEATKHRQAVALVISWVSIVLIYVVVVY
EIIDVLPVPVGALVGPAAVLGAALGFGAQRLVQDLLAGFFIIVEKQYGFG
DLVELSMVGSPENAAGTVEDVTLRVTKLRSSGGEVFTVPNGNIVKSVNLS
KDWARAVVDIPVPTSADLGRVNEVLHQECEHARHDSLLGELLLDEPTVMG
VERIEVDTVTLRLVARTLPGKQFEAGRQLRVLVIRALTRAGIVTAADARA
AVAESPEQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo