Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636285
StrainM_canettii_CIPT_140010059
Protein IDYP_007269912.1
Description Transcriptional regulatory protein WHIB-like WhiB7 [Mycobacterium c
Sequence MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRR
QCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA
gene ID433636285
StrainM_canettii_CIPT_140010059
Protein IDYP_007269912.1
Description Transcriptional regulatory protein WHIB-like WhiB7 [Mycobacterium c
Sequence MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRR
QCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA
gene ID433636285
StrainM_canettii_CIPT_140070017
Protein IDYP_007269912.1
Description Transcriptional regulatory protein WHIB-like WhiB7 [Mycobacterium c
Sequence MSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRR
QCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo