Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636367
StrainM_canettii_CIPT_140010059
Protein IDYP_007269994.1
Description Putative metal cation-transporting P-type ATPase C CtpC [Mycobacter
Sequence MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTG
SVVVWYSPRRADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMV
IGGVALALLGVRRYVFARPPLLGTTGRTVATGVTIFTGYPFLRGALRSLR
SGKAGTDALVSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRA
ISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVRIGDEVVVHEHVAI
PVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA
VGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTSFIVSAIALLIT
GDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAG
RVDAIVFDKTGTLTVGRPVVTNIVAMHKDWEPEQVLAYAASSEIHSRHPL
AEAVIRSTEERRISIPPHEECEVLVGLGMRTWADGRTLLLGSPSLLRAEK
VRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVRPEAAQVLTK
LRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD
GGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHR
LLDVGDLGERAVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNAS
SVAVVANSSRLIRYRLDQTPLRAR
gene ID433636367
StrainM_canettii_CIPT_140010059
Protein IDYP_007269994.1
Description Putative metal cation-transporting P-type ATPase C CtpC [Mycobacter
Sequence MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTG
SVVVWYSPRRADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMV
IGGVALALLGVRRYVFARPPLLGTTGRTVATGVTIFTGYPFLRGALRSLR
SGKAGTDALVSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRA
ISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVRIGDEVVVHEHVAI
PVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA
VGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTSFIVSAIALLIT
GDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAG
RVDAIVFDKTGTLTVGRPVVTNIVAMHKDWEPEQVLAYAASSEIHSRHPL
AEAVIRSTEERRISIPPHEECEVLVGLGMRTWADGRTLLLGSPSLLRAEK
VRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVRPEAAQVLTK
LRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD
GGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHR
LLDVGDLGERAVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNAS
SVAVVANSSRLIRYRLDQTPLRAR
gene ID433636367
StrainM_canettii_CIPT_140070017
Protein IDYP_007269994.1
Description Putative metal cation-transporting P-type ATPase C CtpC [Mycobacter
Sequence MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTG
SVVVWYSPRRADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMV
IGGVALALLGVRRYVFARPPLLGTTGRTVATGVTIFTGYPFLRGALRSLR
SGKAGTDALVSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRA
ISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVRIGDEVVVHEHVAI
PVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA
VGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTSFIVSAIALLIT
GDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAG
RVDAIVFDKTGTLTVGRPVVTNIVAMHKDWEPEQVLAYAASSEIHSRHPL
AEAVIRSTEERRISIPPHEECEVLVGLGMRTWADGRTLLLGSPSLLRAEK
VRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVRPEAAQVLTK
LRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD
GGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHR
LLDVGDLGERAVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNAS
SVAVVANSSRLIRYRLDQTPLRAR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)124
MHC class II prediction (Propred)258
MHC class 1 prediction (Propred1)1036
CTL epitope prediction (CTLpred)310
Prediction of interferon-gamma inducing peptides (IFNepitope)676
Prediction of IL4 inducing peptides (IL4pred)844