Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433636407
StrainM_canettii_CIPT_140010059
Protein IDYP_007270034.1
Description Putative amidohydrolase AmiB1 (aminohydrolase) [Mycobacterium canet
Sequence MPAASASDRVEELVRRRGGELVELSHAIHAEPELAFAEHRSCAKAQALVA
ERGFEITTAAGGLDTAFRADYGSGPLVVGVCAEYDALPGIGHACGHNIIA
ASAVGTALALAEVADDLGLTVALLGTPAEESGGGKALMLQAGTFDDVAVA
VMVHPGPTDIAGARSLALSEVTVRYRGKESHAAVAPHLGVNAADAVTVAQ
VAIGVLRQQLAPGQMVHGIVTDGGQAVNVIPGQARLQYAMRAVESDSLRE
LQTRMFACFAAGALAAGCEYEIDEAAPAYAELKPDPWLADVCREEMQRLG
REPLLPALEAELPLGSTDMGNVTQVLPGIHPVIGLDAGAATVHQRAFTVA
SAGASADRAVVDGAIMLARTVVRLAQTPDERDRVLAAQQRRAAR
gene ID433636407
StrainM_canettii_CIPT_140010059
Protein IDYP_007270034.1
Description Putative amidohydrolase AmiB1 (aminohydrolase) [Mycobacterium canet
Sequence MPAASASDRVEELVRRRGGELVELSHAIHAEPELAFAEHRSCAKAQALVA
ERGFEITTAAGGLDTAFRADYGSGPLVVGVCAEYDALPGIGHACGHNIIA
ASAVGTALALAEVADDLGLTVALLGTPAEESGGGKALMLQAGTFDDVAVA
VMVHPGPTDIAGARSLALSEVTVRYRGKESHAAVAPHLGVNAADAVTVAQ
VAIGVLRQQLAPGQMVHGIVTDGGQAVNVIPGQARLQYAMRAVESDSLRE
LQTRMFACFAAGALAAGCEYEIDEAAPAYAELKPDPWLADVCREEMQRLG
REPLLPALEAELPLGSTDMGNVTQVLPGIHPVIGLDAGAATVHQRAFTVA
SAGASADRAVVDGAIMLARTVVRLAQTPDERDRVLAAQQRRAAR
gene ID433636407
StrainM_canettii_CIPT_140070017
Protein IDYP_007270034.1
Description Putative amidohydrolase AmiB1 (aminohydrolase) [Mycobacterium canet
Sequence MPAASASDRVEELVRRRGGELVELSHAIHAEPELAFAEHRSCAKAQALVA
ERGFEITTAAGGLDTAFRADYGSGPLVVGVCAEYDALPGIGHACGHNIIA
ASAVGTALALAEVADDLGLTVALLGTPAEESGGGKALMLQAGTFDDVAVA
VMVHPGPTDIAGARSLALSEVTVRYRGKESHAAVAPHLGVNAADAVTVAQ
VAIGVLRQQLAPGQMVHGIVTDGGQAVNVIPGQARLQYAMRAVESDSLRE
LQTRMFACFAAGALAAGCEYEIDEAAPAYAELKPDPWLADVCREEMQRLG
REPLLPALEAELPLGSTDMGNVTQVLPGIHPVIGLDAGAATVHQRAFTVA
SAGASADRAVVDGAIMLARTVVRLAQTPDERDRVLAAQQRRAAR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo