Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433640420
StrainM_canettii_CIPT_140070008
Protein IDYP_007286179.1
Description ESX conserved componant EccC3 [Mycobacterium canettii CIPT 14007000
Sequence MSRLIFEARRRLAPPSSHQGTITIEAPPELPRVIPPSLLRRALPYLIGIL
IVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAE
RADYLRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDP
HDPDFLVLRAGRHTVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSI
GDVPTGIDLTKVSRITVLGERAQVRAVLRAWIAQAVTWHDPTVLGVALAA
RDLEGRDWNWLKWLPHVDIPGRLDALGPARNLSTDPDELIALLGPVLADR
PAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVVHCSASAPHRE
QYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFGADEAAHLARRLSRW
DSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPI
GVTGTGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTH
SAERLIVIYADFKGEAGADSFRDFPQVVAVISNMAEKKSLADRFADTLRG
EVARREVLLREAGRKVQGSAFNSVLEYENAIAAGHSLPPIPTLFVVADEF
TLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKDIDKNTAYR
IGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPIRFRSTY
VDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPP
RKLIATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPL
GEIDRPFEMRRDPLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLH
SPHEVSFYCLDYGGGQLRALQDLAHVGSVASALEPERIRRTFGELEQLLL
FRQQREVFRDRGANGSTPDDGFGEVFLVIDNLYGFGRDNTDQFNTRNPLL
ARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRLELRLHDARDSN
VRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAINAR
YPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDFAAN
PLLMVFGDARSGKTTLLRHIIRTVREHSTADQVAFTVLDRRLHLVDEPLF
PDNEYTANIDRIIPAMLGLANLIEARRPPAGMSAAELSRWTFAGHTHYLI
IDDVDQVPDSPAMTGPYIGQRPWTPLIGLLAQAGDLGLRVIVTGRATGSA
HLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRGERFARLPAGRAILLTD
SDSPTYVQLINPLVDAAAVSGETQQKGSQS
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)15
Vaccine TargetYes
B cell prediction (LBtope)102
MHC class II prediction (Propred)208
MHC class 1 prediction (Propred1)933
CTL epitope prediction (CTLpred)217
Prediction of interferon-gamma inducing peptides (IFNepitope)562
Prediction of IL4 inducing peptides (IL4pred)860