Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433640699
StrainM_canettii_CIPT_140070008
Protein IDYP_007286458.1
Description Putative nicotinate phosphoribosyltransferase [Mycobacterium canett
Sequence MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGRSYIMA
AGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAP
EGTVIFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAAR
GRPVVDFGARRAHGTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTM
AHSFVQAFDSEVAAFEAFARLYPATMLLVDTYDTLRGVDHVIELAKRLGN
RFDVRAVRLDSGDLDELSKATRARLDAAGLEQVEIFASSGLDENRIAALL
AARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTKFSSGKVIYPG
RKQVFRRLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLDG
ARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAH
PESNVVGAKAKRP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)2
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)66
MHC class 1 prediction (Propred1)326
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)200
Prediction of IL4 inducing peptides (IL4pred)317