Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433641799
StrainM_canettii_CIPT_140070008
Protein IDYP_007287558.1
Description Putative chalcone synthase Pks10 [Mycobacterium canettii CIPT 14007
Sequence MSVIAGVFGALPPYRYSQRELTDSFVSIPDFEGYEDIVRQLHASAKVNSR
HLVLPLEKYPKLTDFGEANKIFIEKAVDLGVQALAGALDESGLRPEDLDV
LITATVTGLAVPSLDARIAGRLGLRADVRRVPLFGLGCVAGAAGVARLHD
YLRGAPDGVAALVSVELCSLTYPGYKPTLPGLVGSALFADGAAAVVAAGE
KRAQDIGADGPDILDSRSHLYPDSLRTMGYDVGSAGFELVLSRDLAAVVE
QYLGNDVTTFLASHGLSTTDVGAWVTHPGGPKIINAITETLDLSPQALEL
TWRSLGEIGNLSSASVLHVLRDTIAKPPPSGSPGLMIAMGPGFCSELVLL
RWH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)47
MHC class 1 prediction (Propred1)240
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)110
Prediction of IL4 inducing peptides (IL4pred)196