Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433641988
StrainM_canettii_CIPT_140070008
Protein IDYP_007287747.1
Description Putative molybdate-binding lipoprotein ModA [Mycobacterium canettii
Sequence MRWIGLPTGLVSAMLVAGLVACGSNSPASSPAGPTQGARSIVVFAAASLQ
SAFTQIGEQFKAGNPGVNVNFAFAGSSELATQLTQGATADVFASADTAQM
DSVAKAGLLAGQPTNFATNTMVIVAAAGNPKQIRSFADLTRPGLDVVVCQ
PPVPCGSATRRIEDATGIHLNPVSEELSVTDVLNKVITGQADAGLVYVSD
ALSVATKVTCVRFPEAAGVVNVYAIAVLKRTSQPALARQFVAMVTAAAGR
RILDQSGFAKP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)24
MHC class II prediction (Propred)41
MHC class 1 prediction (Propred1)163
CTL epitope prediction (CTLpred)40
Prediction of interferon-gamma inducing peptides (IFNepitope)109
Prediction of IL4 inducing peptides (IL4pred)171