Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433642185
StrainM_canettii_CIPT_140070008
Protein IDYP_007287944.1
Description Heat shock protein HspX (alpha-crystallin homolog) (14 kDa antigen)
Sequence MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGR
YEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVR
TVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
B cell epitope (IEDB)32
T cell epitope (IEDB)236
MHC binder (IEDB)592
Vaccine TargetYes
B cell prediction (LBtope)28
MHC class II prediction (Propred)14
MHC class 1 prediction (Propred1)98
CTL epitope prediction (CTLpred)18
Prediction of interferon-gamma inducing peptides (IFNepitope)71
Prediction of IL4 inducing peptides (IL4pred)53