Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 433642644 |
Strain | M_canettii_CIPT_140070008 |
Protein ID | YP_007288403.1 |
Description | Putative nucleoside diphosphate kinase NdkA (NDK) (NDP kinase) (nuc |
Sequence | MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAP GTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 0 |
MHC binder (IEDB) | 0 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 16 |
MHC class II prediction (Propred) | 19 |
MHC class 1 prediction (Propred1) | 84 |
CTL epitope prediction (CTLpred) | 19 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 58 |
Prediction of IL4 inducing peptides (IL4pred) | 88 |