Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433643415
StrainM_canettii_CIPT_140070008
Protein IDYP_007289174.1
Description Alternative RNA polymerase Sigma-E factor (Sigma-24) SigH (RpoE) [M
Sequence MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRN
PADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQ
PAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPE
EFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVAR
DRGFARGEQAHEGVSS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)5
MHC class II prediction (Propred)29
MHC class 1 prediction (Propred1)145
CTL epitope prediction (CTLpred)23
Prediction of interferon-gamma inducing peptides (IFNepitope)93
Prediction of IL4 inducing peptides (IL4pred)148