Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433643429
StrainM_canettii_CIPT_140070008
Protein IDYP_007289188.1
Description Conserved integral membrane protein of unknown function [Mycobacter
Sequence MEVSRALLFELGVLLAVLAVLGAVARRFALSPIPVYLLAGLSLGNGGILG
VAAAGEFIATGAPIGVVLLLLALGLEFSATEFASSLRHHLPSAGVDIVLN
ATPGAVAGWLLGLDGVAILGLAGVTYISSSGVIARLLEDLRRLGNRETPA
VLSVLVLEDFAMAAYLPLFAVLATDGSWLEAVVGMTVAIAALLGAFAASY
RWGHHVGRLVTHPDSEQLLLRVLGITLIVAAVAESLHASAAVGAFLVGLT
LTGETADRARMVLTPLRDLFATIFFLGIGLSVDPGKLVSMLPVALALAAV
TAATKVATGMFAARREGVARRGQLRAGTALVARGEFSLIIIGLAGASIPG
VAALATAYVFVMAIVGPILARYTGGGLPAAAVASN
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)23
MHC class II prediction (Propred)94
MHC class 1 prediction (Propred1)277
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)133
Prediction of IL4 inducing peptides (IL4pred)199