Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433643571
StrainM_canettii_CIPT_140070008
Protein IDYP_007289330.1
Description Halimadienyl diphosphate synthase (type-B diterpene cyclase) [Mycob
Sequence METFRTLLAKAALGNGISSTAYDTAWVAKLGQLDDELSDLALNWLCERQL
PDGSWGAEFPFCYEDRLLSTLAAMISLTSNKHRRRRAAQVEKGLLALKNL
TSGAFEGPQLDIKDATVGFELIAPTLMAEAARLGLAICHEESILGELVGV
REQKLRKLGGSKINKHITAAFSVELAGQDGVGMLDVDNLQETNGSVKYSP
SASAYFALHVKPGDKRALAYISSIIQAGDGGAPAFYQAEIFEIVWSLWNL
SRTDIDVSDPEIVRTYLPYLDHVEQHWVRGRGVGWTGNSTLEDCDTTSVA
YDVLSKFGRSPDIGAVLQFEEADWFRTYFHEVGPSISTNIHVLGALEQAG
YDKCHPRVRKILEFIRSSKEPGRFCWRDKWHRSAYYATAHLICAASNYDD
ALCSDAVGWILNTQRPDGSWGFFDGQATAEETAYCIQALAHWQRHSGTSL
SAQISSAGEWLSQHCEPPYAPLWIAKTLYCSETVVKAAVLSALRLVEESN
Q
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)38
MHC class II prediction (Propred)76
MHC class 1 prediction (Propred1)345
CTL epitope prediction (CTLpred)81
Prediction of interferon-gamma inducing peptides (IFNepitope)229
Prediction of IL4 inducing peptides (IL4pred)352