Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433643736
StrainM_canettii_CIPT_140070008
Protein IDYP_007289495.1
Description Putative cytochrome P450 125 cyp125 [Mycobacterium canettii CIPT 14
Sequence MSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAA
PIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRF
KNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQER
AQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEM
TGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDG
EKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPE
TAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEV
FQDPLTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPD
LKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)41
MHC class II prediction (Propred)63
MHC class 1 prediction (Propred1)291
CTL epitope prediction (CTLpred)62
Prediction of interferon-gamma inducing peptides (IFNepitope)182
Prediction of IL4 inducing peptides (IL4pred)327