Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649138
StrainM_smegmatis_JS623
Protein IDYP_007294140.1
Description ring-hydroxylating dioxygenase- large terminal subunit [Mycobacteri
Sequence MARFPKPPEGSWTEHYPQLGTDPVSYEDSISPEFYEVERNAVFKRAWLNV
GRVEQLPRKGSYFTKEMKVVNTSIILVRTGSGEIKAYHNICRHRGNKLVW
NDMPLEETSGVCRQFTCKYHAWRYDLDGNLTFVQQEGEFFDLDKSRYGLV
PVHCDVWEGFIFVNFAPEPEQSLRDFLGPMITGLEGYPFDKMTSRFYYRS
EVKANWKLYMDAFQEFYHAPVLHANQSPTAYSKAAAEAGFEAPHYRIDGP
HRLVSTSGIRAWEMDSEMRKPMEDICQSGLFGPWDKPDLGEMPAGLNPAK
CEPWGLDSFQLFPNFVILIWGQGWYLTYHYWPTSHNSHIFEGTAYFPQPR
TPRERIAQELAAVSFKEYSLQDANTLEATQTMVESQVIDRFPLCDQEILI
RHLHKETAAWVDDYQRKTAGV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo