Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649148
StrainM_smegmatis_JS623
Protein IDYP_007294150.1
Description Polyketide cyclase / dehydrase and lipid transport [Mycobacterium s
Sequence MWVKEYTGQSAASADRLFDVLADAAAWSEWNAGVAGIEMDGPFEAGTNAT
MTLSDDTVLPFRLVGVEAGRGFEDETPVPDAGVVVRVLHQLTPMENGTQI
TYRCMAEGPDQAAAEVGAAVSADFPDVIAALAARAESVKS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo