Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649156
StrainM_smegmatis_JS623
Protein IDYP_007294158.1
Description Zn-dependent oxidoreductase- NADPH:quinone reductase [Mycobacterium
Sequence MLAAVCDEYGAPDVVGVDYSWPSPAIVSGQVRVKVEAASVNYPDVLLIAN
EYQISIPTPFIPGSEFAGMIVETTSGAEGFAVGDRVTGTMLYGAFAQEVV
IAATALTRIPDGVDKYTAAAFGVAYRTAYHALRSMVRVQAGDELIVLGAG
GGVGLAAVQLGVKLGASVTAVASSTEKLDVAASYGARHLINYRTADLRIV
LKDAIPRGAHAVVDPVGGALSDPALRALGRGGRFVTVGFASGDIPRIPLN
LVLVKGVHVLGFQFQDVPPDEFVRNENELRELLMAMRVQPHICAVYPLEE
TAQALAYVAEGRAIGKVLIDLT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo