Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649209
StrainM_smegmatis_JS623
Protein IDYP_007294211.1
Description succinate dehydrogenase/fumarate reductase flavoprotein subunit [My
Sequence MSDWDTDVDVVVLGSGGAGLTAALTAASSGASVEVYEKAATVGGTTAVSG
GIVWIPAHSRASDGELPVEDAMDYLRAQSLGFMDDELMETFVRTGAEMLD
YVETHSELQFEIAEGFPDYKPELPGGRPGGGRSLNAKPFDLARLGDWRDQ
IMSFPADFSNVGIDAETRTRIHASVDSENGDYCVAGTALIAGLLKGLLDV
GVVPRTNARAVELIGDSTAITGVRISMDGMDIRVRARRGVVLATGGFEWD
TKLVEAYLRGPMRGAVSPPNNTGDGLRMAMAHGADLANMGEAWWVPIVQL
PGDTFEGQPRSRSVRLERTRPRSIIVNRAGKRFLNEAGEYNSMAGPFQYL
DPRDGYANDPAWIVFDSLHLKRYGFLGVAPGEPAPEWFSPSADVAELGTK
TGIDADGLARTLAAWNDHVAHDTDPDFGRGSSAYDGYWGDDKATTTAGKT
LGPIDTAPYYAVPVSVGAMGTKGGPRTDRDGRVFHVNGSVIPGLFAAGNA
MAGATGKAYGGAGGTLGPAMVFGYRAGLAASAR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo