Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649288
StrainM_smegmatis_JS623
Protein IDYP_007294290.1
Description flavin-dependent oxidoreductase- F420-dependent methylene-tetrahydr
Sequence MDIAPHVGGPSRTSYGINAFGCGSGRQRFDTITELGREAEAVGCAAVWSS
ELYSRSATIPMAVLAATTRRVLIGSNIAYGVGRSPLMWTAEARDLDELSG
GRLILGLGNGTATMMQNWHGTSGQAPAARMAELIVVLRKLWRLHEGPVHH
DGQFYTVHVVPGADMSPPLRDHLPIWIAGVNPLMLRTAGQVADGIIGHPM
FTADYVEQVVRPEIAAGASQAGRAADQIVVTGIRMCAIDDDEEAARRRAA
FAIGQYAASRVYDRLFALHGWSGAQLEIREAARDRDSAALIAAVPDAAVD
AIAVACTPQDFPARLQAASQGFDHVDATAPPWGLSDEQTLAATHQILAGI
RAVLSGSSSPVLNGNGQRTEIV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo