Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649289
StrainM_smegmatis_JS623
Protein IDYP_007294291.1
Description enoyl-CoA hydratase/carnithine racemase [Mycobacterium smegmatis JS
Sequence MIDRERQYQTLAVESPADGVVQVTLNRPERLNAMTVPMFDELESLARAIG
EDREVRAMILTGAGKAFCAGYDLDEAEKLPTLGALGMLDLQERAARALSA
VRAIPVPVIAAVNGPAAGGGMSLTLMADIRLGSPAAKFNAAFVRIGLSAG
DLGASWLLPRLIGPSAAAEIGFTGRIVEADEAEQLGLLNRVTGPDDLLEQ
TLEMARKICANSPGGIRMSKRALQANMEIASFAAALELENRGQALLTRCD
DMTEALEAFKAKRPANFSGR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo