Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649354
StrainM_smegmatis_JS623
Protein IDYP_007294356.1
Description transcriptional regulator [Mycobacterium smegmatis JS623]
Sequence MTSASATKNVRDRLIDAAEVCLRAKGIRSTTVSEVADVAGVSRGWLYRHF
PDKVTLLGAAIVRLNDAYWSEAHAVLEQVEGLDRQMGIGIARARGAYDDP
GTLLMKLRMEEPEEFAACAGAGVQGLVPDLADFWSRYLIAARDRGEIHER
TDIAEASEWIARVVLSLATVPGDKLDPSDADAVAAHMRRYVMPGLRAEPA
V
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo