Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649402
StrainM_smegmatis_JS623
Protein IDYP_007294404.1
Description ABC-type dipeptide transport system- periplasmic component [Mycobac
Sequence MKFRRFAVVALIAGLILTGCSGGKKETPQAGGSAEVGTTNDINPQDVSKL
QRGGNLRLALTAFPENFNPLHIDGNSADSAGMLKSSMPRAFRIAADGSMT
LNTDYFTGAELTGTNPQVVTWTINPKAVWSDGTPITWEDIASQIHATSGK
DKAFAAASPNGSDRVESVTRGVDDRQAIMKFAKPYAEWRGMLSGNTMLLP
KSMTSTPEAFNKGQLNGPGPSAGPFIISTVDRTAQRITLTRNPKWWGAPT
LLDSVTYLVLDDAARIPALQNNTIDATGLATLDELTIARGTNGVAIRRAP
GLSWYHFTFNGAPGSILADKNLRLAIARAIDRQTIANVTQRGLADNPVPL
NNHVYVAGQEGYQDNSGVVAFDPEKAKQELDALGWKLNGQFREKDGKQLV
IRDVLYDSLSTRQFGQIAQNNLAQVGVKLDLDTKGGAGFFSNHINVGDFD
IAQFSWVADAFPLSGLPQIYASDGESNFGKIGTPEIDAKIEQTLQELDPA
KARELANEVDKLLWAEGFSLPLTQSPGNVAVRSTLANFGAFGLADADYSK
IGFMKP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo