Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649510
StrainM_smegmatis_JS623
Protein IDYP_007294512.1
Description ATPase component of ABC transporters with duplicated ATPase domain
Sequence MSITCSNLSFSWPDDTPLFTDLSFTVGDGRTGLVAPNGAGKSTLLKLIAG
EYPPTAGTITVAGILGYLPQTLPFVADRSVADVLGVAGVLDALAALEAGN
ADEDVFAAIGDDWDIEERTRAQLDRLGLGHIGFHRRLGSLSGGEVVSLGL
AAQLLKRPEVLLLDEPTNNLDVDARHRLYDALDDFPGCLLLVSHDRVLLD
RMDRIAELYRGEMLFYGGNFTSYQHAVAEAQQVAEANLRNAEQLLKREKR
ERQEARERAARRSSTAARNLKNAGLPKIVAGKLKRDAQESAGKSDDVHAK
RVTEAQSQLDDAERALRDDAIIVLELPDTSVPSGRTVFRAEGLQVCRGGR
KLFADNGIDLNIRGPERIALSGPNGAGKSTLMRVMSGDLQPDAGTLQRAE
GRIAYLSQRLDLLDPDRTVAESLAVYAPSLTHTRRMHLLAQFLFSSNRIH
LPVAALSGGERLRATLVCVLHAEPAPQLLLLDEPTNNLDLVSVDQLEAAL
NAYQGAFVVVSHDERFLADIGIRRRLRLSEGRLAAI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetNo