Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649561
StrainM_smegmatis_JS623
Protein IDYP_007294563.1
Description site-specific recombinase- DNA invertase Pin [Mycobacterium smegmat
Sequence MTCTLGYATASTVEHNLEGQLAELNAAGVDPRRVFTDKLSDSAERVRAGL
HAMLSYARSGDTVIVVAIDRLGRSAAEVTRTIADLTDRGIRLRTLKEGLD
TGTATGRVVAHILTSLAQLDMEHEHHGS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo