Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649566
StrainM_smegmatis_JS623
Protein IDYP_007294568.1
Description Protein of unknown function (DUF1214) [Mycobacterium smegmatis JS62
Sequence MTHESTAAWHELLETLAGLDRSFLEGDRAVTDDRHIADGYRMLATTLGVA
LDTYLFSEPSRPQFVEVNTPFRRDRRWGGDNTDAYYHMCPVDPKRRYRIS
GNKGDSVYFSVTAYNEPSPGQWSDRIVAIMRDDDLDIDDGGNFSFELGPT
PDAAVLMTRDYQADPLTGRPVSWHIEALDEPEPVRHGDAETAAALRASAA
WLRTMFAIVPLAVGVRVDDSHQLGHEISQVANEFADPYQVPDANFGWSAR
DACYAYGSFVLEDDEALVITHRPPKCRFWNLVVWNQFMATHNVNDARSSV
NGHSAVPNADGSVTVVVSRGLTEHPNSLTTLDYPRGNLAFRWFLADEVPA
RPEVQLVKVSDAPTRVD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo