Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649711
StrainM_smegmatis_JS623
Protein IDYP_007294713.1
Description putative esterase of the alpha-beta hydrolase superfamily [Mycobact
Sequence MATKRALVLAGGGLAGIAWETGILRGIADESPDTAQALVDADVLVGTSAG
STVAAQLSSGLGLDALFDRQTTTSSAELNPNVGIDEITDMFLAAMLAPNT
TQAEKLQKIGAVALSTPTVSEAVRRQVIAQRLPSHDWPQRVLRISAIDTA
TGELVTFDNDSGVGLVDAVTASCAVPAVWPPVTISGRRYMDGGVGSSVNM
RLANDCDVAVVLVPSGRNTPSPFSAGAGEEVDAFGGATFGVFADAASIAA
FGPNPLDPACRKPSALAGREQGRRTAAAIADFLGS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo