Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID433649723
StrainM_smegmatis_JS623
Protein IDYP_007294725.1
Description response regulator of citrate/malate metabolism [Mycobacterium smeg
Sequence MISVLIVEDEPLIAEAHRTYLGRLSGFSVVAVAHTARDAMRAASEALAAE
TPIDLVLLDIGLPDANGIALASGLSGLRPAPDIIAITSERDLEMVRAAVG
RGALAYLLKPFTFAAFRDRLERYQRYREALPAGTDAASQAEVDRALAELR
VSSDRSAAPKGAAPGTNDEIARAVRDSVDGITAEEVAKQIGVSRVTAWRY
LERLADEGTVTRQTDYGKAGRPKTRYTWR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo